PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10029057m
Common NameCICLE_v10028931mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family bZIP
Protein Properties Length: 269aa    MW: 29213.5 Da    PI: 6.5006
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10029057mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.12.1e-0986133451
                      XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                       k  +r   NReA r++R++Kka+++ Le++v  L a N++L k+l+ 
  Ciclev10029057m  86 KKTKKRPLGNREAVRKYREKKKARTASLEDEVVRLRAVNQQLLKRLQG 133
                      566778899**********************************99974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.9E-1481151No hitNo description
SMARTSM003381.8E-1183150IPR004827Basic-leucine zipper domain
PfamPF077161.1E-1484140IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.10585132IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.84E-787133No hitNo description
CDDcd146861.81E-1288142No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071294Biological Processcellular response to zinc ion
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MDDGEVDFSN QEMLSANIGD FPSCSMDSFF EDILKDTHAC THTHTCNPPG PDSSHTHTCF  60
HVHTKIVAPT SEDKVSTDDT AESTEKKTKK RPLGNREAVR KYREKKKART ASLEDEVVRL  120
RAVNQQLLKR LQGQAALEAE VARLKCLLVD IRGRIEGEIG SFPYQKSVNN MNLPNPHSAG  180
AYVVNPCNMR CDDQVYCLHP GMEDKSGEGI ELNGQGFSGC EFENLQCVGN QSSGVRELPG  240
CGDGNVATNT HSSATKNRKG GTRAATAG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006422593.10.0hypothetical protein CICLE_v10028931mg
RefseqXP_006422594.10.0hypothetical protein CICLE_v10028931mg
RefseqXP_006422595.10.0hypothetical protein CICLE_v10028931mg
RefseqXP_006422596.10.0hypothetical protein CICLE_v10028931mg
RefseqXP_006422597.10.0hypothetical protein CICLE_v10028931mg
RefseqXP_006422598.10.0hypothetical protein CICLE_v10028931mg
RefseqXP_006422599.10.0hypothetical protein CICLE_v10028931mg
RefseqXP_006422600.10.0hypothetical protein CICLE_v10028931mg
RefseqXP_006422601.10.0hypothetical protein CICLE_v10028931mg
RefseqXP_006486739.10.0PREDICTED: uncharacterized protein LOC102628933
RefseqXP_006486740.10.0PREDICTED: uncharacterized protein LOC102628933
RefseqXP_006486741.10.0PREDICTED: uncharacterized protein LOC102628933
SwissprotQ8GTS21e-114BZP23_ARATH; Basic leucine zipper 23
TrEMBLA0A067FPJ90.0A0A067FPJ9_CITSI; Uncharacterized protein
TrEMBLV4SAH70.0V4SAH7_9R
TrEMBLV4SFQ80.0V4SFQ8_9R
STRINGVIT_03s0038g02420.t011e-143(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.11e-115bZIP family protein